WDR49 anticorps (N-Term)

N° du produit ABIN632570

Détail du produit anti-WDR49 anticorps

Antigène: WDR49 (WD Repeat Domain 49 (WDR49))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR49 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR49 antibody was raised against the N terminal of WDR49

Purification: Affinity purified

Immunogène: WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR49 Blocking Peptide, catalog no. 33R-8708, is also available for use as a blocking control in assays to test for specificity of this WDR49 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR49

Antigène: WDR49 (WD Repeat Domain 49 (WDR49))

Autre désignation: WDR49 (WDR49 Produits)

Synonymes: anticorps EG213248, anticorps RGD1564622, anticorps WD repeat domain 49, anticorps WDR49, anticorps Wdr49, anticorps wdr49

Sujet: WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.

Poids moléculaire: 79 kDa (MW of target protein)