GLUD2 anticorps (N-Term)
-
- Antigène Voir toutes GLUD2 Anticorps
- GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLUD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLUD2 antibody was raised against the N terminal of GLUD2
- Purification
- Affinity purified
- Immunogène
- GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
- Top Product
- Discover our top product GLUD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLUD2 Blocking Peptide, catalog no. 33R-2428, is also available for use as a blocking control in assays to test for specificity of this GLUD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))
- Autre désignation
- GLUD2 (GLUD2 Produits)
- Synonymes
- anticorps GDH2, anticorps GLUDP1, anticorps GLUTAMATE DEHYDROGENASE 2, anticorps T2I1.150, anticorps T2I1_150, anticorps glutamate dehydrogenase 2, anticorps glutamate dehydrogenase 2, anticorps glutamate dehydrogenase, anticorps GLUD2, anticorps GDH2, anticorps NP_RS03950
- Sujet
- Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-