C18ORF25 anticorps (N-Term)

N° du produit ABIN632578

Détail du produit anti-C18ORF25 anticorps

Antigène: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C18ORF25 est non-conjugé

Application: Western Blotting (WB)

Specificité: C18 orf25 antibody was raised against the N terminal of C18 rf25

Purification: Affinity purified

Immunogène: C18 orf25 antibody was raised using the N terminal of C18 rf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C18orf25 Blocking Peptide, catalog no. 33R-6153, is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C18ORF25

Antigène: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Autre désignation: C18orf25 (C18ORF25 Produits)

Synonymes: anticorps ARKL1, anticorps Akd2, anticorps chromosome 18 open reading frame 25, anticorps chromosome 18 open reading frame 25 L homeolog, anticorps chromosome W open reading frame, human C18orf25, anticorps chromosome 18 open reading frame, human C18orf25, anticorps RIKEN cDNA 8030462N17 gene, anticorps C18orf25, anticorps c18orf25.L, anticorps c18orf25, anticorps CWH18ORF25, anticorps C18H18orf25, anticorps 8030462N17Rik

Sujet: The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 37 kDa (MW of target protein)