KLHDC9 anticorps (Middle Region)
-
- Antigène Tous les produits KLHDC9
- KLHDC9 (Kelch Domain Containing 9 (KLHDC9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHDC9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLHDC9 antibody was raised against the middle region of KLHDC9
- Purification
- Affinity purified
- Immunogène
- KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHDC9 Blocking Peptide, catalog no. 33R-1143, is also available for use as a blocking control in assays to test for specificity of this KLHDC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHDC9 (Kelch Domain Containing 9 (KLHDC9))
- Autre désignation
- KLHDC9 (KLHDC9 Produits)
- Synonymes
- anticorps KARCA1, anticorps 1190002J23Rik, anticorps AA087357, anticorps ESTM31, anticorps kelch domain containing 9, anticorps KLHDC9, anticorps Klhdc9
- Sujet
- The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 38 kDa (MW of target protein)
-