KLHDC9 anticorps (Middle Region)

N° du produit ABIN632579

Détail du produit anti-KLHDC9 anticorps

Antigène: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHDC9 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLHDC9 antibody was raised against the middle region of KLHDC9

Purification: Affinity purified

Immunogène: KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHDC9 Blocking Peptide, catalog no. 33R-1143, is also available for use as a blocking control in assays to test for specificity of this KLHDC9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHDC9

Antigène: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Autre désignation: KLHDC9 (KLHDC9 Produits)

Synonymes: anticorps KARCA1, anticorps 1190002J23Rik, anticorps AA087357, anticorps ESTM31, anticorps kelch domain containing 9, anticorps KLHDC9, anticorps Klhdc9

Sujet: The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 38 kDa (MW of target protein)