C1orf144 anticorps (N-Term)

N° du produit ABIN632581

Détail du produit anti-C1orf144 anticorps

Antigène: C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf144 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 orf144 antibody was raised against the N terminal of C1 rf144

Purification: Affinity purified

Immunogène: C1 orf144 antibody was raised using the N terminal of C1 rf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1orf144 Blocking Peptide, catalog no. 33R-6383, is also available for use as a blocking control in assays to test for specificity of this C1orf144 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf144 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf144

Antigène: C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))

Autre désignation: C1orf144 (C1orf144 Produits)

Synonymes: anticorps MGC82291, anticorps MGC76116, anticorps DKFZp468H135, anticorps C1orf144, anticorps SZRD1, anticorps 1110022I03, anticorps D4Ertd22e, anticorps C2H1orf144, anticorps wu:fb15h05, anticorps wu:fk86c07, anticorps zgc:109926, anticorps RGD1560286, anticorps SUZ RNA binding domain containing 1 L homeolog, anticorps SUZ RNA binding domain containing 1, anticorps szrd1.L, anticorps szrd1, anticorps SZRD1, anticorps Szrd1

Sujet: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 15 kDa (MW of target protein)