C17orf75 anticorps (Middle Region)
-
- Antigène Voir toutes C17orf75 Anticorps
- C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C17orf75 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C17 orf75 antibody was raised against the middle region of C17 rf75
- Purification
- Affinity purified
- Immunogène
- C17 orf75 antibody was raised using the middle region of C17 rf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE
- Top Product
- Discover our top product C17orf75 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C17orf75 Blocking Peptide, catalog no. 33R-4513, is also available for use as a blocking control in assays to test for specificity of this C17orf75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))
- Autre désignation
- C17orf75 (C17orf75 Produits)
- Synonymes
- anticorps NJMU-R1, anticorps C17orf75, anticorps DKFZp469B234, anticorps chromosome 18 C17orf75 homolog, anticorps chromosome 17 open reading frame 75 L homeolog, anticorps chromosome 17 open reading frame, human C17orf75, anticorps chromosome 17 open reading frame 75, anticorps RIKEN cDNA 5730455P16 gene, anticorps C18H17orf75, anticorps c17orf75.L, anticorps C17H17orf75, anticorps C17orf75, anticorps 5730455P16Rik
- Sujet
- The C17orf75 may have a role in spermatogenesis.
- Poids moléculaire
- 44 kDa (MW of target protein)
-