HS1BP3 anticorps (N-Term)

N° du produit ABIN632591

Détail du produit anti-HS1BP3 anticorps

Antigène: HS1BP3 (HCLS1 Binding Protein 3 (HS1BP3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HS1BP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: HS1 BP3 antibody was raised against the N terminal of HS1 P3

Purification: Affinity purified

Immunogène: HS1 BP3 antibody was raised using the N terminal of HS1 P3 corresponding to a region with amino acids YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HS1BP3 Blocking Peptide, catalog no. 33R-10239, is also available for use as a blocking control in assays to test for specificity of this HS1BP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HS1BP3

Antigène: HS1BP3 (HCLS1 Binding Protein 3 (HS1BP3))

Autre désignation: HS1BP3 (HS1BP3 Produits)

Synonymes: anticorps HS1BP3, anticorps DKFZp468N116, anticorps ETM2, anticorps HS1-BP3, anticorps RGD1311331, anticorps HCLS1 binding protein 3, anticorps HCLS1 binding protein 3 S homeolog, anticorps HS1BP3, anticorps hs1bp3.S, anticorps hs1bp3, anticorps Hs1bp3

Sujet: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Poids moléculaire: 43 kDa (MW of target protein)