MTRR anticorps (N-Term)

N° du produit ABIN632593

Détail du produit anti-MTRR anticorps

Antigène: MTRR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase (MTRR))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTRR est non-conjugé

Application: Western Blotting (WB)

Specificité: MTRR antibody was raised against the N terminal of MTRR

Purification: Affinity purified

Immunogène: MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTRR Blocking Peptide, catalog no. 33R-10071, is also available for use as a blocking control in assays to test for specificity of this MTRR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTRR

Antigène: MTRR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase (MTRR))

Autre désignation: MTRR (MTRR Produits)

Synonymes: anticorps MSR, anticorps 4732420G08, anticorps cblE, anticorps MTRR, anticorps 5-methyltetrahydrofolate-homocysteine methyltransferase reductase, anticorps Mtrr, anticorps MTRR, anticorps mtrr

Sujet: Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process