ALDH7A1 anticorps (N-Term)

N° du produit ABIN632598

Détail du produit anti-ALDH7A1 anticorps

Antigène: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH7A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ALDH7 A1 antibody was raised against the N terminal of ALDH7 1

Purification: Affinity purified

Immunogène: ALDH7 A1 antibody was raised using the N terminal of ALDH7 1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH7A1 Blocking Peptide, catalog no. 33R-6842, is also available for use as a blocking control in assays to test for specificity of this ALDH7A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH7A1

Antigène: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Autre désignation: ALDH7A1 (ALDH7A1 Produits)

Synonymes: anticorps atq1, anticorps ALDH7A1, anticorps ATQ1, anticorps EPD, anticorps PDE, anticorps antiquitin, anticorps ATQ, anticorps wu:fi34d12, anticorps wu:fi35e06, anticorps Atq1, anticorps D18Wsu181e, anticorps aldehyde dehydrogenase 7 family member A1, anticorps aldehyde dehydrogenase 7 family member A1 L homeolog, anticorps aldehyde dehydrogenase 7 family, member A1, anticorps aldehyde dehydrogenase family 7, member A1, anticorps ALDH7A1, anticorps aldh7a1, anticorps aldh7a1.L, anticorps Aldh7a1

Sujet: Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Sensory Perception of Sound