C3orf33 anticorps (Middle Region)
-
- Antigène Tous les produits C3orf33
- C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C3orf33 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C3 orf33 antibody was raised against the middle region of C3 rf33
- Purification
- Affinity purified
- Immunogène
- C3 orf33 antibody was raised using the middle region of C3 rf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))
- Autre désignation
- C3orf33 (C3orf33 Produits)
- Synonymes
- anticorps AC3-33, anticorps MGC99235, anticorps chromosome 3 open reading frame 33, anticorps chromosome 3 open reading frame 33 L homeolog, anticorps RIKEN cDNA E130311K13 gene, anticorps C3orf33, anticorps c3orf33.L, anticorps E130311K13Rik
- Sujet
- The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 29 kDa (MW of target protein)
-