CRY2 anticorps
-
- Antigène Voir toutes CRY2 Anticorps
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRY2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
- Top Product
- Discover our top product CRY2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cryptochrome 2 Blocking Peptide, catalog no. 33R-3945, is also available for use as a blocking control in assays to test for specificity of this Cryptochrome 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRY2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
- Autre désignation
- Cryptochrome 2 (CRY2 Produits)
- Synonymes
- anticorps Cry2, anticorps Cry, anticorps GB10211, anticorps CRY2, anticorps AT-PHH1, anticorps ATCRY2, anticorps CRYPTOCHROME 2 APOPROTEIN, anticorps F19P19.14, anticorps F19P19_14, anticorps FHA, anticorps PHH1, anticorps cryptochrome 2, anticorps HCRY2, anticorps PHLL2, anticorps AV006279, anticorps D130054K12Rik, anticorps gCry2, anticorps cryptochrome circadian regulator 2, anticorps cryptochrome 2, anticorps cryptochrome Cry2, anticorps cryptochrome circadian clock 2, anticorps cryptochrome 2 (photolyase-like), anticorps CRY2, anticorps Cry2, anticorps cry2, anticorps LOC100502533
- Sujet
- CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Protein targeting to Nucleus
-