THYN1 anticorps (N-Term)

N° du produit ABIN632610

Détail du produit anti-THYN1 anticorps

Antigène: THYN1 (Thymocyte Nuclear Protein 1 (THYN1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THYN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: THYN1 antibody was raised against the N terminal of THYN1

Purification: Affinity purified

Immunogène: THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THYN1 Blocking Peptide, catalog no. 33R-6487, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THYN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THYN1

Antigène: THYN1 (Thymocyte Nuclear Protein 1 (THYN1))

Autre désignation: THYN1 (THYN1 Produits)

Synonymes: anticorps my105, anticorps thy28, anticorps mds012, anticorps hspc144, anticorps thy28kd, anticorps zgc:66269, anticorps MDS012, anticorps MY105, anticorps THY28, anticorps THY28KD, anticorps D730042P09Rik, anticorps HSPC144, anticorps Thy28, anticorps thymocyte nuclear protein 1, anticorps Thymocyte nuclear protein 1, anticorps thyn1, anticorps THYN1, anticorps PTRG_09699, anticorps MCYG_02665, anticorps EIO_2684, anticorps thYN1, anticorps Thyn1

Sujet: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Poids moléculaire: 26 kDa (MW of target protein)