GBP2 anticorps (N-Term)

N° du produit ABIN632613

Détail du produit anti-GBP2 anticorps

Antigène: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GBP2 antibody was raised against the N terminal of GBP2

Purification: Affinity purified

Immunogène: GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GBP2 Blocking Peptide, catalog no. 33R-3881, is also available for use as a blocking control in assays to test for specificity of this GBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GBP2

Antigène: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Autre désignation: GBP2 (GBP2 Produits)

Synonymes: anticorps guanylate binding protein 2, anticorps guanylate binding protein 2, interferon-inducible, anticorps GTP binding protein 2 L homeolog, anticorps GBP2, anticorps Gbp2, anticorps gtpbp2.L

Sujet: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin