C13orf30 anticorps (N-Term)

N° du produit ABIN632614

Détail du produit anti-C13orf30 anticorps

Antigène: C13orf30 (Chromosome 13 Open Reading Frame 30 (C13orf30))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C13orf30 est non-conjugé

Application: Western Blotting (WB)

Specificité: C13 orf30 antibody was raised against the N terminal of C13 rf30

Purification: Affinity purified

Immunogène: C13 orf30 antibody was raised using the N terminal of C13 rf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C13orf30 Blocking Peptide, catalog no. 33R-6063, is also available for use as a blocking control in assays to test for specificity of this C13orf30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C13orf30

Antigène: C13orf30 (Chromosome 13 Open Reading Frame 30 (C13orf30))

Autre désignation: C13orf30 (C13orf30 Produits)

Synonymes: anticorps C12H13orf30, anticorps C13orf30, anticorps 9330158N17, anticorps AU021034, anticorps family with sequence similarity 216 member B, anticorps family with sequence similarity 216, member B, anticorps FAM216B, anticorps Fam216b

Sujet: The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 16 kDa (MW of target protein)