XRRA1 anticorps (N-Term)

N° du produit ABIN632615

Détail du produit anti-XRRA1 anticorps

Antigène: XRRA1 (X-Ray Radiation Resistance Associated 1 (XRRA1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XRRA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: XRRA1 antibody was raised against the N terminal of XRRA1

Purification: Affinity purified

Immunogène: XRRA1 antibody was raised using the N terminal of XRRA1 corresponding to a region with amino acids MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XRRA1 Blocking Peptide, catalog no. 33R-5652, is also available for use as a blocking control in assays to test for specificity of this XRRA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRRA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XRRA1

Antigène: XRRA1 (X-Ray Radiation Resistance Associated 1 (XRRA1))

Autre désignation: XRRA1 (XRRA1 Produits)

Synonymes: anticorps AI449753, anticorps X-ray radiation resistance associated 1, anticorps Xrra1, anticorps XRRA1

Sujet: XRRA1 may be involved in the response of cells to X-ray radiation.

Poids moléculaire: 90 kDa (MW of target protein)