ZPBP2 anticorps (Middle Region)
-
- Antigène Voir toutes ZPBP2 Anticorps
- ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZPBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZPBP2 antibody was raised against the middle region of ZPBP2
- Purification
- Affinity purified
- Immunogène
- ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG
- Top Product
- Discover our top product ZPBP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZPBP2 Blocking Peptide, catalog no. 33R-9776, is also available for use as a blocking control in assays to test for specificity of this ZPBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))
- Autre désignation
- ZPBP2 (ZPBP2 Produits)
- Synonymes
- anticorps ZPBP2, anticorps ZPBPL, anticorps 1700017D11Rik, anticorps 2610022C02Rik, anticorps zona pellucida binding protein 2, anticorps ZPBP2, anticorps Zpbp2
- Sujet
- ZPBP2 may be implicated in gamete interaction during fertilization.
- Poids moléculaire
- 35 kDa (MW of target protein)
-