ZPBP2 anticorps (Middle Region)

N° du produit ABIN632617

Détail du produit anti-ZPBP2 anticorps

Antigène: ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZPBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZPBP2 antibody was raised against the middle region of ZPBP2

Purification: Affinity purified

Immunogène: ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZPBP2 Blocking Peptide, catalog no. 33R-9776, is also available for use as a blocking control in assays to test for specificity of this ZPBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZPBP2

Antigène: ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))

Autre désignation: ZPBP2 (ZPBP2 Produits)

Synonymes: anticorps ZPBP2, anticorps ZPBPL, anticorps 1700017D11Rik, anticorps 2610022C02Rik, anticorps zona pellucida binding protein 2, anticorps ZPBP2, anticorps Zpbp2

Sujet: ZPBP2 may be implicated in gamete interaction during fertilization.

Poids moléculaire: 35 kDa (MW of target protein)