AKR1C2 anticorps

N° du produit ABIN632618

Détail du produit anti-AKR1C2 anticorps

Antigène: AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKR1C2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKR1C2 Blocking Peptide, catalog no. 33R-4880, is also available for use as a blocking control in assays to test for specificity of this AKR1C2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKR1C2

Antigène: AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))

Autre désignation: AKR1C2 (AKR1C2 Produits)

Synonymes: anticorps AKR1C-pseudo, anticorps BABP, anticorps DD, anticorps DD2, anticorps DDH2, anticorps HAKRD, anticorps HBAB, anticorps MCDR2, anticorps SRXY8, anticorps Akr1c21, anticorps aldo-keto reductase family 1 member C2, anticorps aldo-keto reductase family 1, member C2, anticorps AKR1C2, anticorps Akr1c2

Sujet: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process