SPATA24 anticorps (C-Term)

N° du produit ABIN632623

Détail du produit anti-SPATA24 anticorps

Antigène: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA24 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA24 antibody was raised against the c terminal of SPATA24

Purification: Affinity purified

Immunogène: SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA24 Blocking Peptide, catalog no. 33R-5332, is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA24

Antigène: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Autre désignation: SPATA24 (SPATA24 Produits)

Synonymes: anticorps CCDC161, anticorps T6441, anticorps 2700012K08Rik, anticorps 4930583E11Rik, anticorps 5133400G04Rik, anticorps AU016220, anticorps TIPT, anticorps TIPT2, anticorps RGD1311742, anticorps spermatogenesis associated 24, anticorps SPATA24, anticorps Spata24

Sujet: SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.

Poids moléculaire: 23 kDa (MW of target protein)