ACTR1B anticorps
-
- Antigène Voir toutes ACTR1B Anticorps
- ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTR1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACTR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL
- Top Product
- Discover our top product ACTR1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACTR1B Blocking Peptide, catalog no. 33R-9566, is also available for use as a blocking control in assays to test for specificity of this ACTR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))
- Autre désignation
- ACTR1B (ACTR1B Produits)
- Synonymes
- anticorps ARP1B, anticorps CTRN2, anticorps PC3, anticorps 2310066K23Rik, anticorps AA960180, anticorps AI851923, anticorps Arp1b, anticorps ACTR1B, anticorps ARP1 actin related protein 1 homolog B, anticorps ARP1 actin-related protein 1B, centractin beta, anticorps ARP1 actin-related protein 1 homolog B, anticorps ARP1 actin-related protein 1 homolog B, centractin beta (yeast), anticorps beta-centractin, anticorps ACTR1B, anticorps Actr1b, anticorps LOC100594459
- Sujet
- ACTR1B is a 42.3 kDa subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.
- Poids moléculaire
- 42 kDa (MW of target protein)
-