RPE anticorps (N-Term)

N° du produit ABIN632630

Détail du produit anti-RPE anticorps

Antigène: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPE est non-conjugé

Application: Western Blotting (WB)

Specificité: RPE antibody was raised against the N terminal of RPE

Purification: Affinity purified

Immunogène: RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPE Blocking Peptide, catalog no. 33R-1339, is also available for use as a blocking control in assays to test for specificity of this RPE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPE

Antigène: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Autre désignation: RPE (RPE Produits)

Synonymes: anticorps wu:fa07h08, anticorps wu:fb93d11, anticorps wu:fc20b11, anticorps ik:tdsubc_2c8, anticorps xx:tdsubc_2c8, anticorps RPE2-1, anticorps 2810429B02Rik, anticorps 5730518J08Rik, anticorps ribulose-5-phosphate-3-epimerase, anticorps rpe, anticorps RPE, anticorps Rpe

Sujet: RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.

Poids moléculaire: 19 kDa (MW of target protein)