PLAT anticorps (Middle Region)
-
- Antigène Voir toutes PLAT Anticorps
- PLAT (Plasminogen Activator, Tissue (PLAT))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLAT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PLAT antibody was raised against the middle region of PLAT
- Purification
- Affinity purified
- Immunogène
- PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR
- Top Product
- Discover our top product PLAT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLAT Blocking Peptide, catalog no. 33R-9356, is also available for use as a blocking control in assays to test for specificity of this PLAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLAT (Plasminogen Activator, Tissue (PLAT))
- Autre désignation
- PLAT (PLAT Produits)
- Synonymes
- anticorps T-PA, anticorps TPA, anticorps AU020998, anticorps AW212668, anticorps D8Ertd2e, anticorps tPA, anticorps PATISS, anticorps tpa, anticorps Plat, anticorps plat, anticorps t-pa, anticorps plasminogen activator, tissue type, anticorps plasminogen activator, tissue, anticorps chromosome 20 open reading frame 181, anticorps plasminogen activator, tissue L homeolog, anticorps PLAT, anticorps Plat, anticorps plat, anticorps C20orf181, anticorps plat.L
- Sujet
- This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Autophagy, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, SARS-CoV-2 Protein Interactome
-