THNSL2 anticorps
-
- Antigène Voir toutes THNSL2 Anticorps
- THNSL2 (threonine Synthase-Like 2 (THNSL2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp THNSL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
- Top Product
- Discover our top product THNSL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
THNSL2 Blocking Peptide, catalog no. 33R-5274, is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THNSL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- THNSL2 (threonine Synthase-Like 2 (THNSL2))
- Autre désignation
- THNSL2 (THNSL2 Produits)
- Synonymes
- anticorps BC051244, anticorps TSH2, anticorps SOFAT, anticorps THS2, anticorps RGD1309144, anticorps Tsh2, anticorps zgc:123281, anticorps threonine synthase-like 2 (bacterial), anticorps threonine synthase like 2, anticorps threonine synthase-like 2, anticorps Thnsl2, anticorps THNSL2, anticorps thnsl2
- Sujet
- THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.
- Poids moléculaire
- 54 kDa (MW of target protein)
-