PLSCR1 anticorps (N-Term)

N° du produit ABIN632641

Détail du produit anti-PLSCR1 anticorps

Antigène: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLSCR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLSCR1 antibody was raised against the N terminal of PLSCR1

Purification: Affinity purified

Immunogène: PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLSCR1 Blocking Peptide, catalog no. 33R-5843, is also available for use as a blocking control in assays to test for specificity of this PLSCR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLSCR1

Antigène: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Autre désignation: PLSCR1 (PLSCR1 Produits)

Synonymes: anticorps mmtra1b, anticorps MGC84969, anticorps PLSCR1, anticorps MGC148322, anticorps MMTRA1B, anticorps MmTRA1a, anticorps MmTRA1b, anticorps Nor1, anticorps Tra1, anticorps Tra1a, anticorps Tra1b, anticorps Tras1, anticorps Tras2, anticorps PLSCR2, anticorps phospholipid scramblase 1 L homeolog, anticorps phospholipid scramblase 1, anticorps plscr1.L, anticorps PLS1, anticorps PVX_111580, anticorps PLSCR1, anticorps plscr1, anticorps Plscr1, anticorps LOC100712949, anticorps PLSCR2, anticorps LOC100341366, anticorps LOC611500

Sujet: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin