OSBPL1A anticorps (Middle Region)
-
- Antigène Voir toutes OSBPL1A Anticorps
- OSBPL1A (Oxysterol Binding Protein-Like 1A (OSBPL1A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OSBPL1A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OSBPL1 A antibody was raised against the middle region of OSBPL1
- Purification
- Affinity purified
- Immunogène
- OSBPL1 A antibody was raised using the middle region of OSBPL1 corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI
- Top Product
- Discover our top product OSBPL1A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OSBPL1A Blocking Peptide, catalog no. 33R-2425, is also available for use as a blocking control in assays to test for specificity of this OSBPL1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OSBPL1A (Oxysterol Binding Protein-Like 1A (OSBPL1A))
- Autre désignation
- OSBPL1A (OSBPL1A Produits)
- Synonymes
- anticorps ORP-1, anticorps ORP1, anticorps OSBPL1B, anticorps G430090F17Rik, anticorps Gm753, anticorps Osbpl1b, anticorps si:dkey-121a11.8, anticorps DKFZp459N1538, anticorps oxysterol binding protein like 1A, anticorps oxysterol binding protein-like 1A, anticorps oxysterol-binding protein-related protein 1, anticorps oxysterol binding protein like 1A L homeolog, anticorps OSBPL1A, anticorps Osbpl1a, anticorps osbpl1a, anticorps Tsp_09273, anticorps Tsp_03387, anticorps osbpl1a.L
- Sujet
- This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist, they encode different isoforms.
- Poids moléculaire
- 108 kDa (MW of target protein)
-