LRRC23 anticorps (N-Term)

N° du produit ABIN632645

Détail du produit anti-LRRC23 anticorps

Antigène: LRRC23 (Leucine Rich Repeat Containing 23 (LRRC23))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC23 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC23 antibody was raised against the N terminal of LRRC23

Purification: Affinity purified

Immunogène: LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC23 Blocking Peptide, catalog no. 33R-4931, is also available for use as a blocking control in assays to test for specificity of this LRRC23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC23

Antigène: LRRC23 (Leucine Rich Repeat Containing 23 (LRRC23))

Autre désignation: LRRC23 (LRRC23 Produits)

Synonymes: anticorps LRPB7, anticorps 4921537K05Rik, anticorps B7, anticorps Lrpb7, anticorps leucine rich repeat containing 23, anticorps LRRC23, anticorps Lrrc23

Sujet: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Poids moléculaire: 40 kDa (MW of target protein)