FAM160B1 anticorps (N-Term)

N° du produit ABIN632652

Détail du produit anti-FAM160B1 anticorps

Antigène: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM160B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM160 B1 antibody was raised against the N terminal of FAM160 1

Purification: Affinity purified

Immunogène: FAM160 B1 antibody was raised using the N terminal of FAM160 1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM160B1 Blocking Peptide, catalog no. 33R-3884, is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM160 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM160B1

Antigène: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Autre désignation: FAM160B1 (FAM160B1 Produits)

Synonymes: anticorps zgc:162264, anticorps kiaa1600, anticorps KIAA1600, anticorps bA106M7.3, anticorps AI450540, anticorps mKIAA1600, anticorps RGD1306116, anticorps family with sequence similarity 160, member B1, anticorps family with sequence similarity 160 member B1, anticorps family with sequence similarity 160 member B1 S homeolog, anticorps fam160b1, anticorps FAM160B1, anticorps Fam160b1, anticorps fam160b1.S

Sujet: The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 86 kDa (MW of target protein)