DDHD2 anticorps (N-Term)

N° du produit ABIN632655

Détail du produit anti-DDHD2 anticorps

Antigène: DDHD2 (DDHD Domain Containing 2 (DDHD2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDHD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DDHD2 antibody was raised against the N terminal of DDHD2

Purification: Affinity purified

Immunogène: DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDHD2 Blocking Peptide, catalog no. 33R-1971, is also available for use as a blocking control in assays to test for specificity of this DDHD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDHD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDHD2

Antigène: DDHD2 (DDHD Domain Containing 2 (DDHD2))

Autre désignation: DDHD2 (DDHD2 Produits)

Synonymes: anticorps SAMWD1, anticorps SPG54, anticorps 2010305K11Rik, anticorps mKIAA0725, anticorps DDHD domain containing 2, anticorps DDHD2, anticorps Ddhd2, anticorps ddhd2

Sujet: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

Poids moléculaire: 81 kDa (MW of target protein)