CDC27 anticorps
-
- Antigène Voir toutes CDC27 Anticorps
- CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDC27 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST
- Top Product
- Discover our top product CDC27 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDC27 Blocking Peptide, catalog no. 33R-4514, is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))
- Autre désignation
- CDC27 (CDC27 Produits)
- Synonymes
- anticorps ANAPC3, anticorps APC3, anticorps CDC27Hs, anticorps D0S1430E, anticorps D17S978E, anticorps HNUC, anticorps NUC2, anticorps wu:fb54g06, anticorps wu:fc88c12, anticorps AI452358, anticorps BC023187, anticorps CDC27, anticorps NV10210, anticorps cell division cycle 27, anticorps cell division cycle 27 S homeolog, anticorps cell division cycle protein 27 homolog, anticorps anaphase-promoting complex subunit Apc3, anticorps CDC27, anticorps cdc27, anticorps Cdc27, anticorps cdc27.S, anticorps LOC100123129, anticorps nuc2
- Sujet
- The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.
- Poids moléculaire
- 92 kDa (MW of target protein)
-