CAMK1G anticorps (N-Term)

N° du produit ABIN632661

Détail du produit anti-CAMK1G anticorps

Antigène: CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAMK1G est non-conjugé

Application: Western Blotting (WB)

Specificité: CAMK1 G antibody was raised against the N terminal of CAMK1

Purification: Affinity purified

Immunogène: CAMK1 G antibody was raised using the N terminal of CAMK1 corresponding to a region with amino acids SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAMK1G Blocking Peptide, catalog no. 33R-8410, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAMK1G

Antigène: CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))

Autre désignation: CAMK1G (CAMK1G Produits)

Synonymes: anticorps camk1g, anticorps wu:fk53c02, anticorps zgc:73127, anticorps CAMK1G, anticorps Ci-CaM-K, anticorps wu:fk61c03, anticorps zgc:73155, anticorps CLICK-III, anticorps CaMKIgamma, anticorps CLICK3, anticorps CLICKIII, anticorps VWS1, anticorps dJ272L16.1, anticorps calcium/calmodulin-dependent protein kinase IGa, anticorps calcium/calmodulin-dependent protein kinase IG, anticorps calmodulin-dependent protein kinase homologue, anticorps calcium/calmodulin dependent protein kinase IG, anticorps calcium/calmodulin-dependent protein kinase IGb, anticorps calcium/calmodulin-dependent protein kinase I gamma, anticorps camk1ga, anticorps CAMK1G, anticorps cam-k, anticorps camk1gb, anticorps Camk1g

Sujet: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Poids moléculaire: 53 kDa (MW of target protein)