HOMER1 anticorps
-
- Antigène Voir toutes HOMER1 Anticorps
- HOMER1 (Homer Homolog 1 (HOMER1))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HOMER1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
- Top Product
- Discover our top product HOMER1 Anticorps primaire
-
anti-Homer Homolog 1 (HOMER1) (Center) antibody
HOMER1 Reactivité: Humain, Souris, Rat WB, IF, IHC (p), ICC, IP Hôte: Lapin Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 1-354) antibodyHOMER1 Reactivité: Humain WB, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 96-122), (N-Term) antibodyHOMER1 Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB18229 unconjugated
anti-Homer Homolog 1 (HOMER1) antibodyHOMER1 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 1-354) antibodyHOMER1 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 101-150) antibodyHOMER1 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Porc, Singe, Roussette (Chauve-souris), Xenopus laevis WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 1-354) antibodyHOMER1 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 1-354) antibodyHOMER1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal AT1F3 unconjugated
anti-Homer Homolog 1 (HOMER1) (AA 281-330) antibodyHOMER1 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Porc, Cobaye, Poisson zèbre (Danio rerio), Singe, Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-Homer Homolog 1 (HOMER1) (N-Term) antibodyHOMER1 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Porc WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HOMER1 Blocking Peptide, catalog no. 33R-2502, is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HOMER1 (Homer Homolog 1 (HOMER1))
- Autre désignation
- HOMER1 (HOMER1 Produits)
- Synonymes
- anticorps HOMER, anticorps HOMER1A, anticorps HOMER1B, anticorps HOMER1C, anticorps SYN47, anticorps Ves-1, anticorps HOMER1, anticorps PSD-Zip45, anticorps homer1, anticorps zgc:100854, anticorps zgc:92844, anticorps HOMER1F, anticorps Vesl-1, anticorps homer, anticorps xhomer1, anticorps BEST:LD03829, anticorps CG11324, anticorps Dhom, anticorps Dhomer, anticorps Dm Homer, anticorps Dmel\CG11324, anticorps Dvh, anticorps Hom, anticorps Homer, anticorps LD03829, anticorps dhom, anticorps homer scaffolding protein 1, anticorps homer scaffolding protein 1b, anticorps homer scaffolding protein 1 L homeolog, anticorps CG11324 gene product from transcript CG11324-RD, anticorps HOMER1, anticorps Homer1, anticorps homer1b, anticorps homer1.L, anticorps homer
- Sujet
- HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-
