FAM82B anticorps (N-Term)

N° du produit ABIN632672

Détail du produit anti-FAM82B anticorps

Antigène: FAM82B (RMDN1) (Regulator of Microtubule Dynamics 1 (RMDN1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM82B est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM82 B antibody was raised against the N terminal of FAM82

Purification: Affinity purified

Immunogène: FAM82 B antibody was raised using the N terminal of FAM82 corresponding to a region with amino acids MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM82B Blocking Peptide, catalog no. 33R-5682, is also available for use as a blocking control in assays to test for specificity of this FAM82B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM82B

Antigène: FAM82B (RMDN1) (Regulator of Microtubule Dynamics 1 (RMDN1))

Autre désignation: FAM82B (RMDN1 Produits)

Synonymes: anticorps Fam82b, anticorps RMD-1, anticorps FAM82B, anticorps RMD1, anticorps fam82b, anticorps rmdn1, anticorps regulator of microtubule dynamics 1, anticorps Regulator of microtubule dynamics protein 1, anticorps regulator of microtubule dynamics 1 S homeolog, anticorps Rmdn1, anticorps RMDN1, anticorps rmd-1, anticorps rmdn1.S

Sujet: The specific function of FAM82B is not yet known.

Poids moléculaire: 36 kDa (MW of target protein)