FAM113A anticorps (N-Term)

N° du produit ABIN632679

Détail du produit anti-FAM113A anticorps

Antigène: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM113A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM113 A antibody was raised against the N terminal of FAM113

Purification: Affinity purified

Immunogène: FAM113 A antibody was raised using the N terminal of FAM113 corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM113A Blocking Peptide, catalog no. 33R-9674, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM113A

Antigène: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Autre désignation: FAM113A (FAM113A Produits)

Synonymes: anticorps C20orf81, anticorps FAM113A, anticorps bA12M19.1, anticorps A930025D01Rik, anticorps AI480484, anticorps Fam113a, anticorps RGD1308836, anticorps PC-esterase domain containing 1A, anticorps PCED1A, anticorps Pced1a

Sujet: FAM113A is involved in protein binding and hydrolase activity.

Poids moléculaire: 52 kDa (MW of target protein)