FAM113A anticorps (C-Term)
-
- Antigène Voir toutes FAM113A Anticorps
- FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM113A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM113 A antibody was raised against the C terminal of FAM113
- Purification
- Affinity purified
- Immunogène
- FAM113 A antibody was raised using the C terminal of FAM113 corresponding to a region with amino acids YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG
- Top Product
- Discover our top product FAM113A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM113A Blocking Peptide, catalog no. 33R-10201, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))
- Autre désignation
- FAM113A (FAM113A Produits)
- Synonymes
- anticorps C20orf81, anticorps FAM113A, anticorps bA12M19.1, anticorps A930025D01Rik, anticorps AI480484, anticorps Fam113a, anticorps RGD1308836, anticorps PC-esterase domain containing 1A, anticorps PCED1A, anticorps Pced1a
- Sujet
- FAM113A is involved in protein binding and hydrolase activity.
- Poids moléculaire
- 52 kDa (MW of target protein)
-