ADSSL1 anticorps (Middle Region)

N° du produit ABIN632681

Détail du produit anti-ADSSL1 anticorps

Antigène: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADSSL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADSSL1 antibody was raised against the middle region of ADSSL1

Purification: Affinity purified

Immunogène: ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADSSL1 Blocking Peptide, catalog no. 33R-9461, is also available for use as a blocking control in assays to test for specificity of this ADSSL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADSSL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADSSL1

Antigène: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Autre désignation: ADSSL1 (ADSSL1 Produits)

Sujet: ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC 6.3.4.4), which catalyzes the initial reaction in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP).

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process