PPP1R27 anticorps (Middle Region)

N° du produit ABIN632687

Détail du produit anti-PPP1R27 anticorps

Antigène: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R27 est non-conjugé

Application: Western Blotting (WB)

Specificité: DYSFIP1 antibody was raised against the middle region of DYSFIP1

Purification: Affinity purified

Immunogène: DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYSFIP1 Blocking Peptide, catalog no. 33R-1976, is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSFIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP1R27

Antigène: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Autre désignation: DYSFIP1 (PPP1R27 Produits)

Synonymes: anticorps DYSFIP1, anticorps 1110033I14Rik, anticorps Dysfip1, anticorps toonin, anticorps RGD1308861, anticorps protein phosphatase 1 regulatory subunit 27, anticorps protein phosphatase 1, regulatory subunit 27, anticorps PPP1R27, anticorps Ppp1r27

Sujet: The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 17 kDa (MW of target protein)