LIPJ anticorps (C-Term)

N° du produit ABIN632690

Détail du produit anti-LIPJ anticorps

Antigène: LIPJ (Lipase, Family Member J (LIPJ))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIPJ est non-conjugé

Application: Western Blotting (WB)

Specificité: Lipase J antibody was raised against the C terminal of LIPJ

Purification: Affinity purified

Immunogène: Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipase J Blocking Peptide, catalog no. 33R-5229, is also available for use as a blocking control in assays to test for specificity of this Lipase J antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIPJ

Antigène: LIPJ (Lipase, Family Member J (LIPJ))

Autre désignation: Lipase J (LIPJ Produits)

Synonymes: anticorps LIPL1, anticorps bA425M17.2, anticorps lipase family member J, anticorps LIPJ

Sujet: LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.

Poids moléculaire: 42 kDa (MW of target protein)