LRRC17 anticorps (Middle Region)

N° du produit ABIN632693

Détail du produit anti-LRRC17 anticorps

Antigène: LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC17 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC17 antibody was raised against the middle region of LRRC17

Purification: Affinity purified

Immunogène: LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC17 Blocking Peptide, catalog no. 33R-10275, is also available for use as a blocking control in assays to test for specificity of this LRRC17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC17

Antigène: LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))

Autre désignation: LRRC17 (LRRC17 Produits)

Synonymes: anticorps P37NB, anticorps 37kDa, anticorps 4833425M04Rik, anticorps 6130400C22Rik, anticorps P37nb, anticorps leucine rich repeat containing 17, anticorps Lrrc17, anticorps LRRC17

Sujet: LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.

Poids moléculaire: 52 kDa (MW of target protein)