C4orf33 anticorps (C-Term)

N° du produit ABIN632694

Détail du produit anti-C4orf33 anticorps

Antigène: C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C4orf33 est non-conjugé

Application: Western Blotting (WB)

Specificité: C4 ORF33 antibody was raised against the C terminal Of C4 rf33

Purification: Affinity purified

Immunogène: C4 ORF33 antibody was raised using the C terminal Of C4 rf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4ORF33 Blocking Peptide, catalog no. 33R-7238, is also available for use as a blocking control in assays to test for specificity of this C4ORF33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C4orf33

Antigène: C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))

Autre désignation: C4ORF33 (C4orf33 Produits)

Synonymes: anticorps C4H4orf33, anticorps MGC108272, anticorps MGC197879, anticorps chromosome 4 open reading frame 33, anticorps chromosome 4 C4orf33 homolog, anticorps zgc:77739, anticorps C4orf33, anticorps C4H4orf33, anticorps c4orf33, anticorps zgc:77739

Sujet: C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.

Poids moléculaire: 23 kDa (MW of target protein)