DYNC1I1 anticorps (N-Term)

N° du produit ABIN632697

Détail du produit anti-DYNC1I1 anticorps

Antigène: DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYNC1I1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DYNC1 I1 antibody was raised against the N terminal of DYNC1 1

Purification: Affinity purified

Immunogène: DYNC1 I1 antibody was raised using the N terminal of DYNC1 1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYNC1I1 Blocking Peptide, catalog no. 33R-4130, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYNC1I1

Antigène: DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))

Autre désignation: DYNC1I1 (DYNC1I1 Produits)

Synonymes: anticorps Dnci1, anticorps Dncic1, anticorps DH IC-1, anticorps DHIC-1, anticorps DIC, anticorps IC74, anticorps DNCI1, anticorps DNCIC1, anticorps dynein cytoplasmic 1 intermediate chain 1, anticorps Dync1i1, anticorps DYNC1I1

Sujet: DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

Poids moléculaire: 73 kDa (MW of target protein)