DYNC1I1 anticorps (N-Term)
-
- Antigène Voir toutes DYNC1I1 Anticorps
- DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DYNC1I1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DYNC1 I1 antibody was raised against the N terminal of DYNC1 1
- Purification
- Affinity purified
- Immunogène
- DYNC1 I1 antibody was raised using the N terminal of DYNC1 1 corresponding to a region with amino acids GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFL
- Top Product
- Discover our top product DYNC1I1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DYNC1I1 Blocking Peptide, catalog no. 33R-3577, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))
- Autre désignation
- DYNC1I1 (DYNC1I1 Produits)
- Synonymes
- anticorps Dnci1, anticorps Dncic1, anticorps DH IC-1, anticorps DHIC-1, anticorps DIC, anticorps IC74, anticorps DNCI1, anticorps DNCIC1, anticorps dynein cytoplasmic 1 intermediate chain 1, anticorps Dync1i1, anticorps DYNC1I1
- Sujet
- The aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3B1 is highly expressed in kidney and lung.
- Poids moléculaire
- 73 kDa (MW of target protein)
-