LRRC42 anticorps (N-Term)

N° du produit ABIN632704

Détail du produit anti-LRRC42 anticorps

Antigène: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC42 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC42 antibody was raised against the N terminal of LRRC42

Purification: Affinity purified

Immunogène: LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC42 Blocking Peptide, catalog no. 33R-5043, is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC42

Antigène: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Autre désignation: LRRC42 (LRRC42 Produits)

Synonymes: anticorps dJ167A19.4, anticorps A930011F22Rik, anticorps AA536996, anticorps RGD1308919, anticorps wu:fe17g08, anticorps zgc:56446, anticorps zgc:77847, anticorps leucine rich repeat containing 42, anticorps leucine rich repeat containing 42 L homeolog, anticorps LRRC42, anticorps Lrrc42, anticorps lrrc42.L, anticorps lrrc42

Sujet: The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 48 kDa (MW of target protein)