LRRC42 anticorps (N-Term)
-
- Antigène Voir toutes LRRC42 Anticorps
- LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC42 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRC42 antibody was raised against the N terminal of LRRC42
- Purification
- Affinity purified
- Immunogène
- LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR
- Top Product
- Discover our top product LRRC42 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC42 Blocking Peptide, catalog no. 33R-5043, is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC42 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))
- Autre désignation
- LRRC42 (LRRC42 Produits)
- Synonymes
- anticorps dJ167A19.4, anticorps A930011F22Rik, anticorps AA536996, anticorps RGD1308919, anticorps wu:fe17g08, anticorps zgc:56446, anticorps zgc:77847, anticorps leucine rich repeat containing 42, anticorps leucine rich repeat containing 42 L homeolog, anticorps LRRC42, anticorps Lrrc42, anticorps lrrc42.L, anticorps lrrc42
- Sujet
- The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 48 kDa (MW of target protein)
-