C8orf34 anticorps (N-Term)

N° du produit ABIN632705

Détail du produit anti-C8orf34 anticorps

Antigène: C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C8orf34 est non-conjugé

Application: Western Blotting (WB)

Specificité: C8 ORF34 antibody was raised against the N terminal Of C8 rf34

Purification: Affinity purified

Immunogène: C8 ORF34 antibody was raised using the N terminal Of C8 rf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C8ORF34 Blocking Peptide, catalog no. 33R-6548, is also available for use as a blocking control in assays to test for specificity of this C8ORF34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C8orf34

Antigène: C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))

Autre désignation: C8ORF34 (C8orf34 Produits)

Synonymes: anticorps C2H8orf34, anticorps VEST-1, anticorps VEST1, anticorps C8orf34, anticorps chromosome 2 open reading frame, human C8orf34, anticorps chromosome 8 open reading frame 34, anticorps chromosome 29 C8orf34 homolog, anticorps C2H8ORF34, anticorps C8orf34, anticorps C29H8orf34

Sujet: The function of C8orf34 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 47 kDa (MW of target protein)