C20orf141 anticorps (Middle Region)

N° du produit ABIN632707

Détail du produit anti-C20orf141 anticorps

Antigène: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C20orf141 est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF141 antibody was raised against the middle region of C20 rf141

Purification: Affinity purified

Immunogène: C20 ORF141 antibody was raised using the middle region of C20 rf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF141 Blocking Peptide, catalog no. 33R-3864, is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF141 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C20orf141

Antigène: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Autre désignation: C20ORF141 (C20orf141 Produits)

Synonymes: anticorps dJ860F19.4, anticorps chromosome 20 open reading frame 141, anticorps chromosome 10 C20orf141 homolog, anticorps C20orf141, anticorps C10H20orf141

Sujet: The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 17 kDa (MW of target protein)