C20orf141 anticorps (Middle Region)
-
- Antigène Tous les produits C20orf141
- C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C20orf141 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C20 ORF141 antibody was raised against the middle region of C20 rf141
- Purification
- Affinity purified
- Immunogène
- C20 ORF141 antibody was raised using the middle region of C20 rf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C20ORF141 Blocking Peptide, catalog no. 33R-3864, is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF141 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))
- Autre désignation
- C20ORF141 (C20orf141 Produits)
- Synonymes
- anticorps dJ860F19.4, anticorps chromosome 20 open reading frame 141, anticorps chromosome 10 C20orf141 homolog, anticorps C20orf141, anticorps C10H20orf141
- Sujet
- The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 17 kDa (MW of target protein)
-