Sialidase 4 anticorps (N-Term)
-
- Antigène Voir toutes Sialidase 4 (NEU4) Anticorps
- Sialidase 4 (NEU4)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Sialidase 4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NEU4 antibody was raised against the N terminal of NEU4
- Purification
- Affinity purified
- Immunogène
- NEU4 antibody was raised using the N terminal of NEU4 corresponding to a region with amino acids TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE
- Top Product
- Discover our top product NEU4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NEU4 Blocking Peptide, catalog no. 33R-9097, is also available for use as a blocking control in assays to test for specificity of this NEU4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Sialidase 4 (NEU4)
- Autre désignation
- NEU4 (NEU4 Produits)
- Synonymes
- anticorps 9330166I04, anticorps neuraminidase 4, anticorps sialidase 4, anticorps NEU4, anticorps Neu4
- Sujet
- NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.
- Poids moléculaire
- 53 kDa (MW of target protein)
-