DUSP19 anticorps (C-Term)

N° du produit ABIN632710

Détail du produit anti-DUSP19 anticorps

Antigène: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DUSP19 est non-conjugé

Application: Western Blotting (WB)

Specificité: DUSP19 antibody was raised against the C terminal of DUSP19

Purification: Affinity purified

Immunogène: DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DUSP19 Blocking Peptide, catalog no. 33R-8399, is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DUSP19

Antigène: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Autre désignation: DUSP19 (DUSP19 Produits)

Synonymes: anticorps Dusp19, anticorps skrp1, anticorps dusp17, anticorps ts-dsp1, anticorps MGC85046, anticorps si:dkey-237j22.1, anticorps DKFZp469B171, anticorps DUSP17, anticorps LMWDSP3, anticorps SKRP1, anticorps TS-DSP1, anticorps 5930436K22Rik, anticorps C79103, anticorps dual specificity phosphatase 19b, anticorps dual specificity phosphatase 19, anticorps dual specificity phosphatase 19 L homeolog, anticorps dual specificity phosphatase 19a, anticorps dusp19b, anticorps DUSP19, anticorps dusp19, anticorps dusp19.L, anticorps dusp19a, anticorps Dusp19

Sujet: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Poids moléculaire: 24 kDa (MW of target protein)