KIAA1958 anticorps (C-Term)

N° du produit ABIN632714

Détail du produit anti-KIAA1958 anticorps

Antigène: KIAA1958

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIAA1958 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA1958 antibody was raised against the C terminal of KIAA1958

Purification: Affinity purified

Immunogène: KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1958 Blocking Peptide, catalog no. 33R-8678, is also available for use as a blocking control in assays to test for specificity of this KIAA1958 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1958 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIAA1958

Antigène: KIAA1958

Autre désignation: KIAA1958 (KIAA1958 Produits)

Synonymes: anticorps KIAA1958, anticorps KIAA1958 ortholog, anticorps KIAA1958, anticorps kiaa1958

Sujet: The function of KIAA1958 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 62 kDa (MW of target protein)