JOSD2 anticorps (N-Term)

N° du produit ABIN632715

Détail du produit anti-JOSD2 anticorps

Antigène: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JOSD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: JOSD2 antibody was raised against the N terminal of JOSD2

Purification: Affinity purified

Immunogène: JOSD2 antibody was raised using the N terminal of JOSD2 corresponding to a region with amino acids QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JOSD2 Blocking Peptide, catalog no. 33R-7694, is also available for use as a blocking control in assays to test for specificity of this JOSD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JOSD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JOSD2

Antigène: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Autre désignation: JOSD2 (JOSD2 Produits)

Synonymes: anticorps 1110007C05Rik, anticorps RGD1307305, anticorps zgc:55937, anticorps Josephin domain containing 2, anticorps Josephin domain containing 2 L homeolog, anticorps Josd2, anticorps josd2.L, anticorps JOSD2, anticorps josd2

Sujet: The specific function of JOSD2 is not yet known.

Poids moléculaire: 21 kDa (MW of target protein)