FAM83F anticorps (Middle Region)

N° du produit ABIN632716

Détail du produit anti-FAM83F anticorps

Antigène: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM83F est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM83 F antibody was raised against the middle region of FAM83

Purification: Affinity purified

Immunogène: FAM83 F antibody was raised using the middle region of FAM83 corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM83F Blocking Peptide, catalog no. 33R-3043, is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM83F

Antigène: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Autre désignation: FAM83F (FAM83F Produits)

Synonymes: anticorps AW544981, anticorps RGD1562089, anticorps zgc:92122, anticorps family with sequence similarity 83, member F, anticorps family with sequence similarity 83 member F, anticorps family with sequence similarity 83, member Fb, anticorps Fam83f, anticorps FAM83F, anticorps fam83fb

Sujet: The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 55 kDa (MW of target protein)