C11ORF74 anticorps (Middle Region)
-
- Antigène Voir toutes C11ORF74 Anticorps
- C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C11ORF74 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C11 ORF74 antibody was raised against the middle region of C11 rf74
- Purification
- Affinity purified
- Immunogène
- C11 ORF74 antibody was raised using the middle region of C11 rf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
- Top Product
- Discover our top product C11ORF74 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C11ORF74 Blocking Peptide, catalog no. 33R-9749, is also available for use as a blocking control in assays to test for specificity of this C11ORF74 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF74 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))
- Autre désignation
- C11ORF74 (C11ORF74 Produits)
- Synonymes
- anticorps HEPIS, anticorps chromosome 11 open reading frame 74, anticorps chromosome 5 C11orf74 homolog, anticorps C11orf74, anticorps C5H11orf74, anticorps c11orf74
- Sujet
- The function of C11orf74 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 25 kDa (MW of target protein)
-