C16ORF46 anticorps (N-Term)

N° du produit ABIN632731

Détail du produit anti-C16ORF46 anticorps

Antigène: C16ORF46 (Chromosome 16 Open Reading Frame 46 (C16ORF46))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C16ORF46 est non-conjugé

Application: Western Blotting (WB)

Specificité: C16 ORF46 antibody was raised against the N terminal Of C16 rf46

Purification: Affinity purified

Immunogène: C16 ORF46 antibody was raised using the N terminal Of C16 rf46 corresponding to a region with amino acids LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16ORF46 Blocking Peptide, catalog no. 33R-5431, is also available for use as a blocking control in assays to test for specificity of this C16ORF46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C16ORF46

Antigène: C16ORF46 (Chromosome 16 Open Reading Frame 46 (C16ORF46))

Autre désignation: C16ORF46 (C16ORF46 Produits)

Synonymes: anticorps chromosome 16 open reading frame 46, anticorps chromosome 18 open reading frame, human C16orf46, anticorps chromosome 16 C16orf46 homolog, anticorps C16orf46, anticorps C18H16orf46, anticorps C16H16orf46

Sujet: The function of C16orf46 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 43 kDa (MW of target protein)